General Information

  • ID:  hor005688
  • Uniprot ID:  Q90WF4
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  npy
  • Organism:  Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Paralichthys (genus), Paralichthyidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSPEILDTLVSELLLKESTDTLPQSRYDPSLW
  • Length:  32(68-99)
  • Propeptide:  MHPNLVSWLGTLGLLLWALLCLSALTEGYPVKPENPGDDAPAEELAKYYSALRHYINLITRQRYGKRSSPEILDTLVSELLLKESTDTLPQSRYDPSLW
  • Signal peptide:  MHPNLVSWLGTLGLLLWALLCLSALTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q90WF4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005688_AF2.pdbhor005688_ESM.pdb

Physical Information

Mass: 418716 Formula: C162H258N38O56
Absent amino acids: ACFGHMN Common amino acids: L
pI: 3.82 Basic residues: 2
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -35.94 Boman Index: -5512
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 106.56
Instability Index: 9714.69 Extinction Coefficient cystines: 6990
Absorbance 280nm: 225.48

Literature

  • PubMed ID:  11944964
  • Title:  Development of neuropeptide Y-related peptides in the digestive organs during the larval stage of Japanese flounder, Paralichthys olivaceus.